Annexin A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59124

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Bovine

Cited:

Bovine

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Annexin A2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ANXA2 (annexin A2) The peptide sequence was selected from the C terminal of ANXA2 (NP_004030). Peptide sequence: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 23565988).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Annexin A2 Antibody - BSA Free

Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124] - Titration: 1.25ug/ml, Positive Control: Human Lung.
Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124]

Annexin-A2-Antibody-Western-Blot-NBP1-59124-img0006.jpg
Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124]

Western Blot: Annexin A2 Antibody [NBP1-59124] - Lanes: Lane 1: 20 ug mouse GL261 cell lysate Lane 2: 20 ug mouse astrocyte cell lysate Primary Antibody Dilution: 1:250 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:500 Gene Name: ANXA2

Applications for Annexin A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A2

ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.

Alternate Names

ANX2L4, ANXA2, CAL1H, LIP2, Lipocortin-2, LPC2D, PAP-IV

Entrez Gene IDs

302 (Human); 12306 (Mouse); 56611 (Rat); 406192 (Porcine); 396297 (Chicken)

Gene Symbol

ANXA2

UniProt

Q8TBV2 (Human)

Additional Annexin A2 Products

Product Documents for Annexin A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Annexin A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Annexin A2 Antibody - BSA Free

Customer Reviews for Annexin A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin A2 Antibody - BSA Free and earn rewards!

Have you used Annexin A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies