AP1GBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87009

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AP1GBP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human AP1GBP1. Peptide sequence: QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AP1GBP1 Antibody - BSA Free

Western Blot: AP1GBP1 Antibody [NBP2-87009]

Western Blot: AP1GBP1 Antibody [NBP2-87009]

Western Blot: AP1GBP1 Antibody [NBP2-87009] - WB Suggested Anti-SYNRG Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole Cell

Applications for AP1GBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP1GBP1

The AP1GBP1 gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connec

Alternate Names

AP1 gamma subunit binding protein 1, AP1 subunit gamma-binding protein 1, FLJ34482, Gamma-synergin, MGC104959, synergin gamma, synergin, gamma, SYNGAP1GBP1adaptor-related protein complex 1 gamma subunit-binding protein 1

Gene Symbol

SYNRG

Additional AP1GBP1 Products

Product Documents for AP1GBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AP1GBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AP1GBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP1GBP1 Antibody - BSA Free and earn rewards!

Have you used AP1GBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies