AP4S1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82640

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AP4S1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1. Peptide sequence: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AP4S1 Antibody - BSA Free

Western Blot: AP4S1 Antibody [NBP2-82640]

Western Blot: AP4S1 Antibody [NBP2-82640]

Western Blot: AP4S1 Antibody [NBP2-82640] - Host: Rabbit. Target Name: Ap4s1. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml

Applications for AP4S1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP4S1

The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1; MIM 607245) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1).(supplied by OMIM)

Alternate Names

adapter-related protein complex 4 subunit sigma-1, adaptor-related protein complex 4, sigma 1 subunit, AP-4 complex subunit sigma-1, AP47B, CLA20, CLAPS4, CPSQ6, sigma 4, sigma-4-adaptin, sigma4-adaptin

Gene Symbol

AP4S1

Additional AP4S1 Products

Product Documents for AP4S1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AP4S1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AP4S1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP4S1 Antibody - BSA Free and earn rewards!

Have you used AP4S1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies