APOBEC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57268

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all APOBEC1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for APOBEC1 Antibody - BSA Free

Western Blot: APOBEC1 Antibody [NBP1-57268]

Western Blot: APOBEC1 Antibody [NBP1-57268]

Western Blot: APOBEC1 Antibody [NBP1-57268] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Applications for APOBEC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APOBEC1

APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

APOBEC-1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, Apolipoprotein B mRNA-editing enzyme 1, BEDPC->U-editing enzyme APOBEC-1, CDAR1, EC 3.5.4, EC 3.5.4.-, HEPRapolipoprotein B mRNA editing enzyme complex-1

Gene Symbol

APOBEC1

UniProt

P41238 (Human)

Additional APOBEC1 Products

Product Documents for APOBEC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for APOBEC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APOBEC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APOBEC1 Antibody - BSA Free and earn rewards!

Have you used APOBEC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies