Aquaporin-5 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-39043PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AQP5.

Source: E. coli

Amino Acid Sequence: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39043.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-39043PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin 5/AQP5

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Long Name

Aquaporin 5

Alternate Names

AQP-5, AQP5, PPKB

Gene Symbol

AQP5

Additional Aquaporin 5/AQP5 Products

Product Documents for Aquaporin-5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Aquaporin-5 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Aquaporin-5 Recombinant Protein Antigen and earn rewards!

Have you used Aquaporin-5 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...