ARID5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69169

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARID5B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody [NBP1-69169]

Western Blot: ARID5B Antibody [NBP1-69169]

Western Blot: ARID5B Antibody [NBP1-69169] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Applications for ARID5B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARID5B

ARID5B is a DNA-binding protein that binds to the 5'-AATA[CT]-3' core sequence. ARID5B probably acts as a transcription regulator. ARID5B represses the cytomegalovirus enhancer. Overexpression of ARID5B leads to induction of smooth muscle marker genes, suggesting that it may act as a regulator of smooth muscle cell differentiation and proliferation. ARID5B may be involved in lipid stores.

Alternate Names

ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein

Entrez Gene IDs

84159 (Human)

Gene Symbol

ARID5B

UniProt

Q14865 (Human)

Additional ARID5B Products

Product Documents for ARID5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARID5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARID5B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARID5B Antibody - BSA Free and earn rewards!

Have you used ARID5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies