ARID5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87039

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ARID5B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARID5B. Peptide sequence: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody [NBP2-87039]

Western Blot: ARID5B Antibody [NBP2-87039]

Western Blot: ARID5B Antibody [NBP2-87039] - Host: Rabbit. Target Name: ARID5B. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/mlARID5B is supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: ARID5B Antibody [NBP2-87039]

Western Blot: ARID5B Antibody [NBP2-87039]

Western Blot: ARID5B Antibody [NBP2-87039] - Host: Rabbit. Target: ARID5B. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): A549 Cell Lysate (N03). Antibody concentration: 3ug/ml

Applications for ARID5B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARID5B

ARID5B (AT-rich interactive domain-containing protein 5B) is also known as MRF-2 (modulator recognition factor 2) and is member of the AT-rich interaction domain (ARID) family of proteins. Studies of ARID5B in knockout mice indicate a role in the regulation of adipocyte differentiation and leptin expression.

Alternate Names

ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein

Gene Symbol

ARID5B

Additional ARID5B Products

Product Documents for ARID5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARID5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARID5B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARID5B Antibody - BSA Free and earn rewards!

Have you used ARID5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies