ARP10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84468

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ARP10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARP10. Peptide sequence: SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ARP10 Antibody - BSA Free

Western Blot: ARP10 Antibody [NBP2-84468]

Western Blot: ARP10 Antibody [NBP2-84468]

Western Blot: ARP10 Antibody [NBP2-84468] - WB Suggested Anti-APOBEC3H Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for ARP10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARP10

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Alternate Names

APOBEC-related protein 10, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H, ARP-10, ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H, DNA dC->dU-editing enzyme APOBEC-3H, EC 3.5.4.-

Gene Symbol

APOBEC3H

Additional ARP10 Products

Product Documents for ARP10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARP10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARP10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARP10 Antibody - BSA Free and earn rewards!

Have you used ARP10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies