ASF1b Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52947

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASF1b Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ASF1b Antibody - BSA Free

Western Blot: ASF1b Antibody [NBP1-52947]

Western Blot: ASF1b Antibody [NBP1-52947]

Western Blot: ASF1b Antibody [NBP1-52947] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for ASF1b Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASF1b

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Alternate Names

ASF1 silencing function 1 homolog B (S. cerevisiae), CCG1-interacting factor A-II, CIA-II, FLJ10604, hAsf1, hAsf1b, hCIA-II, histone chaperone ASF1B, silencing function protein 1 homolog B

Gene Symbol

ASF1B

UniProt

Q9NVP2 (Human)

Additional ASF1b Products

Product Documents for ASF1b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASF1b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASF1b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASF1b Antibody - BSA Free and earn rewards!

Have you used ASF1b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies