ATP12A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92160

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 890-980 of human ATP12A (NP_001172014.1). YFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

116 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP12A Antibody - Azide and BSA Free

Western Blot: ATP12A AntibodyAzide and BSA Free [NBP2-92160]

Western Blot: ATP12A AntibodyAzide and BSA Free [NBP2-92160]

Western Blot: ATP12A Antibody [NBP2-92160] - Analysis of extracts of various cell lines, using ATP12A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 5s.

Applications for ATP12A Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP12A

ATP12A is encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. [provided by RefSeq]

Alternate Names

ATP1AL1non-gastric H(+)/K(+) ATPase alpha subunit, ATPase, H+/K+ transporting, nongastric, alpha polypeptide, ATPase, Na+/K+ transporting, alpha polypeptide-like 1, EC 3.6.3, EC 3.6.3.10, Non-gastric H(+)/K(+) ATPase subunit alpha, potassium-transporting ATPase alpha chain 2, Proton pump

Gene Symbol

ATP12A

Additional ATP12A Products

Product Documents for ATP12A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP12A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for ATP12A Antibody - Azide and BSA Free

Customer Reviews for ATP12A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ATP12A Antibody - Azide and BSA Free and earn rewards!

Have you used ATP12A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...