ATRX Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55953

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATRX Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATRX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATRX Antibody [NBP2-55953]

Immunocytochemistry/ Immunofluorescence: ATRX Antibody [NBP2-55953]

Immunocytochemistry/Immunofluorescence: ATRX Antibody [NBP2-55953] - Staining of human cell line SH-SY5Y shows localization to nuclear bodies.

Applications for ATRX Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATRX

ATRX is encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Alternate Names

alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX

Gene Symbol

ATRX

Additional ATRX Products

Product Documents for ATRX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATRX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATRX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATRX Antibody - BSA Free and earn rewards!

Have you used ATRX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies