Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84505

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6. Peptide sequence: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody [NBP2-84505]

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody [NBP2-84505]

Western Blot: Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody [NBP2-84505] - Host: Rabbit. Target Name: B3GNT6. Sample Type: PANC1 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6

Beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an importantprecursor in the biosynthesis of mucin-type glycoproteins. Plays an important role in the synthesis of mucin-typeO-glycans in digestive organs

Long Name

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6

Alternate Names

Beta3Gn-T6, BGnT-6, Core 3 synthase

Gene Symbol

B3GNT6

Additional Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Products

Product Documents for Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free and earn rewards!

Have you used Beta-1,3-N-Acetylglucosaminyltransferase 6/B3GNT6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies