beta-Defensin 4/2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79792

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all beta-Defensin 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human DEFB4AThe immunogen for this antibody is DEFB4A. Peptide sequence LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for beta-Defensin 4/2 Antibody - BSA Free

Western Blot: beta-Defensin 4/2 Antibody [NBP1-79792]

Western Blot: beta-Defensin 4/2 Antibody [NBP1-79792]

Western Blot: beta-Defensin 4/2 Antibody [NBP1-79792] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for beta-Defensin 4/2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-Defensin 2

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.

Long Name

Defensin 2 beta

Alternate Names

BD-2, betaDefensin 2, DEFB2, DEFB4A, DEFB4B, HBD-2, SAP-1

Gene Symbol

DEFB4A

UniProt

NP_004933 (Human)

Additional beta-Defensin 2 Products

Product Documents for beta-Defensin 4/2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for beta-Defensin 4/2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta-Defensin 4/2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta-Defensin 4/2 Antibody - BSA Free and earn rewards!

Have you used beta-Defensin 4/2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies