beta I + II Tubulin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83946

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all beta I + II Tubulin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human beta I + II Tubulin. Peptide sequence: EPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for beta I + II Tubulin Antibody - BSA Free

Western Blot: beta I + II Tubulin Antibody [NBP2-83946]

Western Blot: beta I + II Tubulin Antibody [NBP2-83946]

Western Blot: beta I + II Tubulin Antibody [NBP2-83946] - Host: Rabbit. Target Name: TUBB1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for beta I + II Tubulin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta I + II Tubulin

Tubulin is the major building block of microtubules. This intracellular, cylindrical filamentous structure is present in almost all eukaryotic cells. Microtubules function as structural and mobile elements in mitosis, intracellular transport, flagellar movement and the cytoskeleton. Except in the simplest eukaryotes, tubulin exists in all cells as a mixture of similar but not identical sets of alpha and beta tubulin polypeptides. Within either family, individual subunits diverge from each other (both within and across species) at less than 10% of the amino acid positions. The most extreme diversity is localized to the carboxy-terminal 15 residues. For beta-tubulin, five evolutionarily conserved isotype clones have been identified. These are almost totally conserved in the subunits utilized in the same cell types of different species with the exception of the hematopoietic beta tubulin which is highly divergent in sequence and which is not conserved between species. Research has been centered around the hypothesis that these beta tubulin isotypes contribute to unique functional properties. It has been reported that the different isotypes of tubulin differ from each other in their ability to polymerize into microtubules.

Alternate Names

beta tubulin 1, class VI, dJ543J19.4, tubulin beta-1 chain, tubulin, beta 1

Gene Symbol

TUBB1

Additional beta I + II Tubulin Products

Product Documents for beta I + II Tubulin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta I + II Tubulin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta I + II Tubulin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta I + II Tubulin Antibody - BSA Free and earn rewards!

Have you used beta I + II Tubulin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies