beta II Tubulin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88773

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all beta II Tubulin B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human beta II Tubulin B. Peptide sequence: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for beta II Tubulin B Antibody - BSA Free

Western Blot: beta II Tubulin B Antibody [NBP2-88773]

Western Blot: beta II Tubulin B Antibody [NBP2-88773]

Western Blot: beta II Tubulin B Antibody [NBP2-88773] - WB Suggested Anti-TUBB2B Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell
Western Blot: beta II Tubulin B Antibody [NBP2-88773]

Western Blot: beta II Tubulin B Antibody [NBP2-88773]

Western Blot: beta II Tubulin B Antibody [NBP2-88773] - Host: Rabbit. Target Name: TUBB2B. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml

Applications for beta II Tubulin B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta II Tubulin B

Tubulin is the major constituent of microtubules. It exists as a heterodimer consiting of an alpha and a beta subunit. Class II beta tubulin is the major form of tubulin beta in neurons, although it is not neuronal specific. It is found in many other tissues including lung tissue and Schwann cells. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a nonexchangeable site on the alpha chain.

Long Name

Tubulin beta-2B chain

Alternate Names

TUBB2B

Gene Symbol

TUBB2B

Additional beta II Tubulin B Products

Product Documents for beta II Tubulin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for beta II Tubulin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for beta II Tubulin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review beta II Tubulin B Antibody - BSA Free and earn rewards!

Have you used beta II Tubulin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies