New
BLIMP1/PRDM1 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP3-17184PEP
Loading...
Loading...
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLIMP1/PRDM1
Source: E.coli
Amino Acid Sequence: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
>80% by SDS-PAGE and Coomassie blue staining
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17184It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation, and Storage
NBP3-17184PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: BLIMP1/PRDM1
Blimp1 is a nuclear protein with five zinc fingers in its carboxy terminus. The Blimp-1 protein is expressed in, and may be required for terminally differentiated epithelial cells, retinal neurons and other lineage cells. BLIMP-1 has also been implicated in the repression of beta-interferon (IFN-beta) and c-myc gene expression.
Long Name
B Lymphocyte Induced Maturation Protein
Alternate Names
PRDM1, ZNFPR1A1
Gene Symbol
PRDM1
Additional BLIMP1/PRDM1 Products
Product Documents for BLIMP1/PRDM1 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BLIMP1/PRDM1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for BLIMP1/PRDM1 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review BLIMP1/PRDM1 Recombinant Protein Antigen and earn rewards!
Have you used BLIMP1/PRDM1 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Loading...