Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

Novus Biologicals | Catalog # NBP3-16589

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2V4R0 expressed in HEK293
View all Blood Group B Transferase/GTB Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Blood Group B Transferase/GTB/ABO (P16442). MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (2V4R0) [NBP3-16589]

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (2V4R0) [NBP3-16589]

Western Blot: Blood Group B Transferase/GTB/ABO Antibody (2V4R0) [NBP3-16589] - Western blot analysis of extracts of various cell lines, using Blood Group B Transferase/GTB/ABO Rabbit mAb (NBP3-16589) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Applications for Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Blood Group B Transferase/GTB

The ABO gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in anindividual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near theN-terminus of the protein which resu

Long Name

Fucosylglycoprotein 3-alpha-galactosyltransferase

Alternate Names

A3GALT1, ABO

Gene Symbol

ABO

Additional Blood Group B Transferase/GTB Products

Product Documents for Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for Blood Group B Transferase/GTB/ABO Antibody (2V4R0)

There are currently no reviews for this product. Be the first to review Blood Group B Transferase/GTB/ABO Antibody (2V4R0) and earn rewards!

Have you used Blood Group B Transferase/GTB/ABO Antibody (2V4R0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies