BMP-8b Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10677

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all BMP-8b Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BMP-8b (NP_001711.2). Peptide sequence VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit BMP-8b Antibody - BSA Free (NBP3-10677) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for BMP-8b Antibody - BSA Free

Western Blot: BMP-8b Antibody [NBP3-10677]

Western Blot: BMP-8b Antibody [NBP3-10677]

Western Blot: BMP-8b Antibody [NBP3-10677] - Western blot analysis of BMP-8b in 293T Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for BMP-8b Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BMP-8b

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bonegrowth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identifiedby an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site.Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development.In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible boneinductive activity. (provided by RefSeq)

Long Name

Bone Morphogenetic Protein 8b

Alternate Names

OP-3

Gene Symbol

BMP8B

Additional BMP-8b Products

Product Documents for BMP-8b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BMP-8b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

BMP Family

Customer Reviews for BMP-8b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BMP-8b Antibody - BSA Free and earn rewards!

Have you used BMP-8b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies