BST2 Antibody (0F5P3)

Novus Biologicals | Catalog # NBP3-16710

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0F5P3 expressed in HEK293
View all BST-2/Tetherin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human BST2 (Q10589). LQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BST2 Antibody (0F5P3)

Western Blot: BST2 Antibody (0F5P3) [NBP3-16710]

Western Blot: BST2 Antibody (0F5P3) [NBP3-16710]

Western Blot: BST2 Antibody (0F5P3) [NBP3-16710] - Western blot analysis of extracts of various cell lines, using BST2 Rabbit mAb (NBP3-16710) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for BST2 Antibody (0F5P3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BST-2/Tetherin

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq]

Long Name

Bone Marrow Stromal Cell Antigen 2

Alternate Names

BST2, CD317, HM1.24 Antigen, NPC-A-7, Tetherin

Gene Symbol

BST2

Additional BST-2/Tetherin Products

Product Documents for BST2 Antibody (0F5P3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BST2 Antibody (0F5P3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BST2 Antibody (0F5P3)

There are currently no reviews for this product. Be the first to review BST2 Antibody (0F5P3) and earn rewards!

Have you used BST2 Antibody (0F5P3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies