BTG3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05196

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all BTG3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human BTG3 (NP_006797.3). DEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BTG3 Antibody - Azide and BSA Free

Western Blot: BTG3 AntibodyAzide and BSA Free [NBP3-05196]

Western Blot: BTG3 AntibodyAzide and BSA Free [NBP3-05196]

Western Blot: BTG3 Antibody [NBP3-05196] - Analysis of extracts of human liver, using BTG3 antibody. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for BTG3 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:200-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BTG3

The protein encoded by the BTG3 gene is a member of the BTG/Tob family. This family has structurally related proteins thatappear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the centralnervous system. Two transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Alternate Names

Abundant in neuroepithelium area protein, ANATOB55, B-cell translocation gene 3, B-cell translocation gene10, BTG family member 3, BTG family, member 3, MGC8928, protein BTG3, Protein Tob5, tob55, TOB5TOFA

Gene Symbol

BTG3

Additional BTG3 Products

Product Documents for BTG3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BTG3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BTG3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review BTG3 Antibody - Azide and BSA Free and earn rewards!

Have you used BTG3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies