BTN2A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62371

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BTN2A1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BTN2A1(butyrophilin, subfamily 2, member A1) The peptide sequence was selected from the N terminal of BTN2A1. Peptide sequence SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BTN2A1 Antibody - BSA Free

Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371]

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for BTN2A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BTN2A1

The specific functin of this protein remains unknown.This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

Long Name

Butyrophilin Subfamily 2 Member A1

Alternate Names

BT2.1, BTF1

Gene Symbol

BTN2A1

UniProt

Q7KYR7

Additional BTN2A1 Products

Product Documents for BTN2A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BTN2A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BTN2A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BTN2A1 Antibody - BSA Free and earn rewards!

Have you used BTN2A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies