C1q Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00000712-D01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all C1q Primary Antibodies »

Product Specifications

Immunogen

C1QA (NP_057075.1, 1 a.a. - 245 a.a.) full-length human protein. MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Specificity

Reacts with complement component 1, q subcomponent, A chain.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for C1q Antibody - Azide and BSA Free

Western Blot: C1q Antibody [H00000712-D01P]

Western Blot: C1q Antibody [H00000712-D01P]

Western Blot: C1q Antibody [H00000712-D01P] - Analysis of C1QA expression in human kidney.
Western Blot: C1q Antibody [H00000712-D01P]

Western Blot: C1q Antibody [H00000712-D01P]

Western Blot: C1q Antibody [H00000712-D01P] - Analysis of C1QA expression in transfected 293T cell line by C1QA polyclonal antibody.Lane 1: C1QA transfected lysate(26.00 KDa).Lane 2: Non-transfected lysate.

Applications for C1q Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: C1q

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q. [provided by RefSeq]

Alternate Names

A chain, complement component 1, q subcomponent, A chain, complement component 1, q subcomponent, alpha polypeptide

Entrez Gene IDs

712 (Human)

Gene Symbol

C1QA

UniProt

NP_057075.1 (Human)

Additional C1q Products

Product Documents for C1q Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for C1q Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for C1q Antibody - Azide and BSA Free

Customer Reviews for C1q Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review C1q Antibody - Azide and BSA Free and earn rewards!

Have you used C1q Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for C1q Antibody - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking for polyclonal/monoclonal antibodies against canine C1q and complement-related. I was wondering if your prooduct does.

    A:

    Please see the provided link below which will take you to our website and all of our C1Q antibodies that are available. Unfortunately we do not currently have an antibody that has been tested in dog but if that would be something you are interested in doing, I would like to invite you to review our Innovator's rewards program. Should you have any questions or concerns, please do not hesitate to contact me directly. C1Q antibodies: Innovators Rewards Program

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies