CACNA2D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81501

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Rat

Predicted:

Mouse (99%). Backed by our 100% Guarantee.

Applications

Validated:

Knockdown Validated

Cited:

Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CACNA2D2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28469787).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CACNA2D2 Antibody - BSA Free

CACNA2D2 Antibody - BSA Free Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
CACNA2D2 Antibody - BSA Free Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Staining of human duodenum shows no cytoplasmic positivity in glandular cells.
CACNA2D2 Antibody - BSA Free Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
CACNA2D2 Antibody - BSA Free Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501]

Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.

Applications for CACNA2D2 Antibody - BSA Free

Application
Recommended Usage

Knockdown Validated

Use in KD reported in scientific literature (PMID:28469787).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CACNA2D2

The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.

Long Name

Voltage-dependent calcium channel subunit alpha-2/delta-2

Alternate Names

KIAA0558

Gene Symbol

CACNA2D2

Additional CACNA2D2 Products

Product Documents for CACNA2D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CACNA2D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CACNA2D2 Antibody - BSA Free

Customer Reviews for CACNA2D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CACNA2D2 Antibody - BSA Free and earn rewards!

Have you used CACNA2D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies