Calsyntenin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59862

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Calsyntenin-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CLSTN1(calsyntenin 1) Antibody(against the N terminal of CLSTN1. Peptide sequence KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Calsyntenin-1 Antibody - BSA Free

Western Blot: Calsyntenin-1 Antibody [NBP1-59862]

Western Blot: Calsyntenin-1 Antibody [NBP1-59862]

Western Blot: CLSTN1 Antibody [NBP1-59862] - Human kidney lysate, concentration 0.2-1 ug/ml.

Applications for Calsyntenin-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calsyntenin-1

CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation. In complex with APBA2 and C99, a C-terminal APP fragment,CLSTN1 abolishes C99 interaction with PSEN1 and thus APP C99 cleavage by gamma-secretase, most probably through stabilization of the direct interaction between APBA2 and APP. The intracellular fragment AlcICD suppresses APBB1-dependent transactivation stimulated by APP C-terminal intracellular fragment (AICD), most probably by competing with AICD for APBB1-binding.CLSTN1 may modulate calcium-mediated postsynaptic signals.

Alternate Names

Alcadein-alpha, Calsyntenin1, CLSTN1, CS1, CSTN1, XB31alpha

Gene Symbol

CLSTN1

UniProt

O94985 (Human)

Additional Calsyntenin-1 Products

Product Documents for Calsyntenin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Calsyntenin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calsyntenin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calsyntenin-1 Antibody - BSA Free and earn rewards!

Have you used Calsyntenin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies