CAMLG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33661

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CAMLG Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CAMLG Antibody - BSA Free

Western Blot: CAMLG Antibody [NBP2-33661]

Western Blot: CAMLG Antibody [NBP2-33661]

Western Blot: CAMLG Antibody [NBP2-33661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP2-33661]

Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP2-33661]

Immunocytochemistry/Immunofluorescence: CAMLG Antibody [NBP2-33661] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry-Paraffin: CAMLG Antibody [NBP2-33661]

Immunohistochemistry-Paraffin: CAMLG Antibody [NBP2-33661]

Immunohistochemistry-Paraffin: CAMLG Antibody [NBP2-33661] - Staining of human cerebellum shows cytoplasmic and nuclear positivity in Purkinje cells.

Applications for CAMLG Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CAMLG

The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq]

Alternate Names

calcium modulating ligand, calcium signal-modulating cyclophilin ligand, calcium-signal modulating cyclophilin ligand, CAMLcalcium-modulating cyclophilin ligand, cyclophilin B-binding protein, MGC163197

Gene Symbol

CAMLG

UniProt

P49069 (Human)

Additional CAMLG Products

Product Documents for CAMLG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CAMLG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CAMLG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAMLG Antibody - BSA Free and earn rewards!

Have you used CAMLG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies