Carbonic Anhydrase VA/CA5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86595

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Carbonic Anhydrase VA/CA5A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Carbonic Anhydrase VA/CA5A. Peptide sequence: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit Carbonic Anhydrase VA/CA5A Antibody - BSA Free (NBP2-86595) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

Western Blot: Carbonic Anhydrase VA/CA5A Antibody [NBP2-86595]

Western Blot: Carbonic Anhydrase VA/CA5A Antibody [NBP2-86595]

Western Blot: Carbonic Anhydrase VA/CA5A Antibody [NBP2-86595] - WB Suggested Anti-CA5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: A549 cell lysate

Applications for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase VA/CA5A

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq]

Alternate Names

CA5A, CAVA

Gene Symbol

CA5A

Additional Carbonic Anhydrase VA/CA5A Products

Product Documents for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase VA/CA5A Antibody - BSA Free and earn rewards!

Have you used Carbonic Anhydrase VA/CA5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies