Carbonic Anhydrase VII/CA7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68888

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Carbonic Anhydrase VII/CA7 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Carbonic Anhydrase VII/CA7 Antibody - BSA Free

Western Blot: Carbonic Anhydrase VII/CA7 Antibody [NBP1-68888]

Western Blot: Carbonic Anhydrase VII/CA7 Antibody [NBP1-68888]

Western Blot: CA7 Antibody [NBP1-68888] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Applications for Carbonic Anhydrase VII/CA7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase VII/CA7

Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the salivary glands. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.

Alternate Names

CA7

Gene Symbol

CA7

UniProt

Q86YU0 (Human)

Additional Carbonic Anhydrase VII/CA7 Products

Product Documents for Carbonic Anhydrase VII/CA7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Carbonic Anhydrase VII/CA7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Carbonic Anhydrase VII/CA7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Carbonic Anhydrase VII/CA7 Antibody - BSA Free and earn rewards!

Have you used Carbonic Anhydrase VII/CA7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies