Carboxypeptidase B1/CPB1 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-38549PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: HGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVENVLK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-38549PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Carboxypeptidase B1/CPB1
Alternate Names
Gene Symbol
Additional Carboxypeptidase B1/CPB1 Products
Product Documents for Carboxypeptidase B1/CPB1 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Carboxypeptidase B1/CPB1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Carboxypeptidase B1/CPB1 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review Carboxypeptidase B1/CPB1 Recombinant Protein Antigen and earn rewards!
Have you used Carboxypeptidase B1/CPB1 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for Carboxypeptidase B1/CPB1 Recombinant Protein Antigen
-
Q: I am trying to establish ELISA detection for carboxy peptidase. I am using a rat recombinant carboxypeptodase b from Roche diagnostics (cat no.03358682103). Can you please suggest the suitable kit.
A:
Here is a link to our CPB1 products. H00001360-AP21 and H00001360-AP11 may suit your needs.
-
Q: I use porcine carboxypeptidase B (CPB) in my fermentation process. I want to detect the residual CPB in my finished product preferably by ELISA/western blot. How will antibody pairs from Novus Biologics help me do that? Is a colorimetric assay possible with the antibody pair?
A: Any detection system can be employed when using the antibody pairs. The detection system will depend on the secondary used against the detection primary antibody from the pair, and the conjugate on the secondary antibody. The pair will work effectively in capturing the protein of interest, and subsequently detecting it with the second antibody in the pair for ELISA. This pair is not evaluated in Western Blot directly, but there Novus carries similar primary antibodies that we have that are validated in that application.
-
Q: I am trying to establish ELISA detection for carboxy peptidase. I am using a rat recombinant carboxypeptodase b from Roche diagnostics (cat no.03358682103). Can you please suggest the suitable kit.
A:
Here is a link to our CPB1 products. H00001360-AP21 and H00001360-AP11 may suit your needs.
-
Q: I use porcine carboxypeptidase B (CPB) in my fermentation process. I want to detect the residual CPB in my finished product preferably by ELISA/western blot. How will antibody pairs from Novus Biologics help me do that? Is a colorimetric assay possible with the antibody pair?
A: Any detection system can be employed when using the antibody pairs. The detection system will depend on the secondary used against the detection primary antibody from the pair, and the conjugate on the secondary antibody. The pair will work effectively in capturing the protein of interest, and subsequently detecting it with the second antibody in the pair for ELISA. This pair is not evaluated in Western Blot directly, but there Novus carries similar primary antibodies that we have that are validated in that application.