CASZ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87125

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CASZ1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CASZ1. Peptide sequence: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CASZ1 Antibody - BSA Free

Western Blot: CASZ1 Antibody [NBP2-87125]

Western Blot: CASZ1 Antibody [NBP2-87125]

Western Blot: CASZ1 Antibody [NBP2-87125] - 0.2-1 ug/ml. Positive Control: Transfected 293T
Western Blot: CASZ1 Antibody [NBP2-87125]

Western Blot: CASZ1 Antibody [NBP2-87125]

Western Blot: CASZ1 Antibody [NBP2-87125] - Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml.

Applications for CASZ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CASZ1

Probable transcription factor

Alternate Names

castor, castor homolog 1, zinc finger, castor homolog 1, zinc finger (Drosophila), castor zinc finger 1, Castor-related protein, CST, dJ734G22.1, FLJ20321, Putative survival-related protein, SRG, SRGcst, survival related, survival-related, Zinc finger protein 693, zinc finger protein castor homolog 1, ZNF693, ZNF693FLJ12223

Gene Symbol

CASZ1

Additional CASZ1 Products

Product Documents for CASZ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CASZ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CASZ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CASZ1 Antibody - BSA Free and earn rewards!

Have you used CASZ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies