Cathepsin G Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87126

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Cathepsin G Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Cathepsin G. Peptide sequence: SYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Cathepsin G Antibody - BSA Free

Western Blot: Cathepsin G Antibody [NBP2-87126]

Western Blot: Cathepsin G Antibody [NBP2-87126]

Western Blot: Cathepsin G Antibody [NBP2-87126] - WB Suggested Anti-CTSG Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

Applications for Cathepsin G Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cathepsin G

Cathepsin G is encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Alternate Names

cathepsin G, CathepsinG, CGCATG, EC 3.4.21, EC 3.4.21.20, MGC23078

Gene Symbol

CTSG

Additional Cathepsin G Products

Product Documents for Cathepsin G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cathepsin G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cathepsin G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cathepsin G Antibody - BSA Free and earn rewards!

Have you used Cathepsin G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies