CBFA2T3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35460

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 593-653 of human CBFA2T3 (NP_005178.4).

Sequence:
DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CBFA2T3 Antibody - BSA Free

CBFA2T3 Antibody

Western Blot: CBFA2T3 Antibody [NBP3-35460] -

Western Blot: CBFA2T3 Antibody [NBP3-35460] - Western Blot analysis of various lysates using CBFA2T3 Rabbit pAb at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for CBFA2T3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CBFA2T3

The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of this gene. In addition, this gene is a putative breast tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene, and a brefeldin A-sensitive association of RII-alpha protein with one of the isoforms has been demonstrated in the Golgi apparatus. [provided by RefSeq]

Alternate Names

core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b

Gene Symbol

CBFA2T3

Additional CBFA2T3 Products

Product Documents for CBFA2T3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CBFA2T3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CBFA2T3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBFA2T3 Antibody - BSA Free and earn rewards!

Have you used CBFA2T3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...