Cbl-c Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38465

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cbl-c Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 245-474 of human Cbl-c (NP_036248.3).

Sequence:
DEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cbl-c Antibody - BSA Free

Cbl-c Antibody

Western Blot: Cbl-c Antibody [NBP3-38465] -

Western Blot: Cbl-c Antibody [NBP3-38465] - Western blot analysis of various lysates using Cbl-c Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for Cbl-c Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cbl-c

Cbl-c is also known as signal transduction protein CBL-C, SH3-binding protein CBL-C, CBL-3, and RING finger protein 57. Cbl proteins are a family of ubiquitin protein ligases (E3s) that negatively regulate signaling by targeting activated tyrosine kinases for degradation. Cbl-c (a.k.a. Cbl-3) is the most recently cloned member of the Cbl proteins and is expressed only in epithelial cells (the other Cbl proteins are ubiquitously expressed). Cbl-c, like the other mammalian Cbl proteins, can ubiquitinate the activated EGFR and target it for degradation. Cbl-c knock out mice show no obvious phenotype. Thus, the physiological role of Cbl-c is not known

Alternate Names

Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction protein CBL-C

Gene Symbol

CBLC

Additional Cbl-c Products

Product Documents for Cbl-c Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cbl-c Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cbl-c Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cbl-c Antibody - BSA Free and earn rewards!

Have you used Cbl-c Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies