CCAR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35368

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CCAR1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CCAR1 (NP_060707.2).

Sequence:
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

133 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CCAR1 Antibody - BSA Free

CCAR1 Antibody

Western Blot: CCAR1 Antibody [NBP3-35368] -

Western Blot: CCAR1 Antibody [NBP3-35368] - Western blot analysis of various lysates using CCAR1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
CCAR1 Antibody

Immunoprecipitation: CCAR1 Antibody [NBP3-35368] -

Immunoprecipitation: CCAR1 Antibody [NBP3-35368] - Immunoprecipitation analysis of 200 ug extracts of HeLa cells using 3 ug CCAR1 antibody. Western blot was performed from the immunoprecipitate using CCAR1 antibody at a dilution of 1:500.

Applications for CCAR1 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CCAR1

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation. May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein(s) and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation

Alternate Names

CARP-1, CARP1MGC44628, Cell cycle and apoptosis regulatory protein 1, cell division cycle and apoptosis regulator 1, cell division cycle and apoptosis regulator protein 1, Death inducer with SAP domain, DIS, FLJ10590, RP11-437A18.1

Gene Symbol

CCAR1

Additional CCAR1 Products

Product Documents for CCAR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CCAR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CCAR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CCAR1 Antibody - BSA Free and earn rewards!

Have you used CCAR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies