CD1d Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57561

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CD1d Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD1d Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CD1d Antibody [NBP2-57561]

Immunocytochemistry/ Immunofluorescence: CD1d Antibody [NBP2-57561]

Immunocytochemistry/Immunofluorescence: CD1d Antibody [NBP2-57561] - Staining of human cell line HEK 293 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Applications for CD1d Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD1d

CD1d is a 335 amino acid member of the CD1 family of glycoproteins. CD1d is an antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells. CD1 transmembrane glycoproteins are structurally related to major histocombatibility complex (MHC) proteins and they form dimers with beta-2-microglobulin. They are considered non-classical MHC proteins and CD1d is the only member of group 2 CD1 molecules. Diseases related to CD1d include susceptibility to infections such as tuberculosis and malaria, hypersensitivity reaction type II disease, multiple sclerosis, myocarditis, diabetes mellitus, rheumatoid arthritis, asthma and atherosclerosis.

Alternate Names

CD1d, R3, R3G1

Gene Symbol

CD1D

Additional CD1d Products

Product Documents for CD1d Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD1d Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD1d Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD1d Antibody - BSA Free and earn rewards!

Have you used CD1d Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for CD1d Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Do you have an antibody for CD1d that works well on formalin fixed paraffin embedded tissue (specifically for liver tissue)?

    A: We do have a CD1d antibody that has been verified in paraffin-embedded tissue sections. The catalog number is NBP1-43461.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies