CDK5 Activator 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55112

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CDK5 Activator 1 Antibody - BSA Free (NBP2-55112) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CDK5 Activator 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CDK5 Activator 1 Antibody [NBP2-55112]

Immunocytochemistry/ Immunofluorescence: CDK5 Activator 1 Antibody [NBP2-55112]

Immunocytochemistry/Immunofluorescence: CDK5 Activator 1 Antibody [NBP2-55112] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Applications for CDK5 Activator 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDK5 Activator 1

The baculoviruses are a large, diverse family of DNA viruses that have evolved a number of mechanisms to manipulate thier insect hosts. One of these is the ability to regulate apoptosis during infection by expressing proteins that can inhibit caspase activation, including the caspase inhibitor p35 and the inhibitor of apoptosis (IAP) proteins (reviewed in Clem, 2005; Clarke and Clem, 2003; and Iller, 1997). The p35 baculovirus protein strongly inhibits caspase enzymatic activity, and is the the most broadly acting caspase inhibitor protein known. p35 baculovirus forms essentially irreversible complexes with its target caspases in a process that is accompanied by the cleavage of p35, generating two fragments of approximately 10 kDa and 25 kDa. These cleavage fragments remain associated with caspases and thereby block caspase activity. The ability of p35 to inhibit caspases along with the central role of caspases in the apoptotic process enables p35 baculovirus to block apoptosis in a phylogentically broad range of cells, and in response to a wide variety of apoptotic induction signals. For example, over expression of p35 in mammalian, insect, and nematode cells results in resistance to apoptosis. IMG-5740 recognizes p35 baculovirus; p35 baculovirus migrates at ~35 kDa on SDS-PAGE.

Long Name

Cyclin-dependent Kinase 5, Regulatory Subunit 1 (p35)

Alternate Names

CDK5P35, CDK5R1, NCK5A, Neuronal CDK5 Activator, p35nck5a, TPKII Regulatory Subunit

Gene Symbol

CDK5R1

Additional CDK5 Activator 1 Products

Product Documents for CDK5 Activator 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDK5 Activator 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CDK5 Activator 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDK5 Activator 1 Antibody - BSA Free and earn rewards!

Have you used CDK5 Activator 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...