CDK8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92972

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CDK8 Antibody - BSA Free

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of 200ug extracts of Jurkat cells, using CDK8 antibody. Western blot was performed from the immunoprecipitate using this antibody
Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts of Jurkat cells, using CDK8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.
Knockout Validated: CDK8 Antibody - BSA Free [NBP2-92972]

Western Blot: CDK8 Antibody - BSA Free [NBP2-92972]

Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts from normal (control) and CDK8 knockout (KO) HeLa cells, using CDK8 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Applications for CDK8 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:50 - 1:100

Western Blot

1:500 - 1:2000

Reviewed Applications

Read 1 review rated 5 using NBP2-92972 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDK8

Cdk8 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.

Long Name

Cyclin-dependent Kinase 8

Alternate Names

Protein kinase K35

Gene Symbol

CDK8

Additional CDK8 Products

Product Documents for CDK8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDK8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDK8 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CDK8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • CDK8 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: 293t HEK and U2OS cells
    Species: Human
    Verified Customer | Posted 03/31/2021
    left: Hek293 right: CDK Knock down
    CDK8 Antibody - BSA Free NBP2-92972

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail