CEBP Delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56564

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CEBP Delta Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CEBP Delta Antibody [NBP2-56564]

Immunocytochemistry/ Immunofluorescence: CEBP Delta Antibody [NBP2-56564]

Immunocytochemistry/Immunofluorescence: CEBP Delta Antibody [NBP2-56564] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.
CEBP Delta Antibody - BSA Free Chromatin Immunoprecipitation ChIP: CEBP Delta Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: CEBP Delta Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-CEBP Delta tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for CEBP Delta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CEBP Delta

C/EBP proteins are DNA-binding proteins that are important transcriptional activators in the regulation of genes involved in immune and inflammatory responses and may play an important role in the regulation of the several genes associated with activation and/or differentiation of macrophages. Members of the C/EBP transcription factor family are related by a high degree of amino acid sequence identity to the basic leucine zipper DNA-binding domain and show distinct but overlapping patterns of tissue- and stage-restricted expression. Osada et al. identified the consensus binding site for the family as RTTGCGYAAY (R = A or G, and Y = C or T). Phosphorylation of C/EBP delta may increase binding activity, whereas phosphorylation of the alpha and beta family members may decrease binding affinity. C/EBP delta is a nuclear protein that binds DNA as a dimer and can form stable heterodimers with all other C/EBP family members.

Alternate Names

C/EBP-delta, CCAAT/enhancer binding protein (C/EBP), delta, CCAAT/enhancer-binding protein delta, CELF, CRP3, NF-IL6-betaC/EBP delta, Nuclear factor NF-IL6-beta

Gene Symbol

CEBPD

Additional CEBP Delta Products

Product Documents for CEBP Delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CEBP Delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CEBP Delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CEBP Delta Antibody - BSA Free and earn rewards!

Have you used CEBP Delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...