CELSR2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85712
Key Product Details
Species Reactivity
Validated:
Predicted:
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Scientific Data Images for CELSR2 Antibody - BSA Free
Immunohistochemistry-Paraffin: CELSR2 Antibody [NBP1-85712]
Immunohistochemistry-Paraffin: CELSR2 Antibody [NBP1-85712] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.Applications for CELSR2 Antibody - BSA Free
Immunohistochemistry
Immunohistochemistry-Paraffin
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: CELSR2
Long Name
Alternate Names
Gene Symbol
Additional CELSR2 Products
Product Documents for CELSR2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CELSR2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CELSR2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CELSR2 Antibody - BSA Free and earn rewards!
Have you used CELSR2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for CELSR2 Antibody - BSA Free
-
Q: Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
A: H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.