Ceramide Kinase Like Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68988

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ceramide Kinase Like Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ceramide Kinase Like Antibody - BSA Free

Western Blot: Ceramide Kinase Like Antibody [NBP1-68988]

Western Blot: Ceramide Kinase Like Antibody [NBP1-68988]

Western Blot: Ceramide Kinase Like Antibody [NBP1-68988] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Applications for Ceramide Kinase Like Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ceramide Kinase Like

This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.

Alternate Names

ceramide kinase-like, ceramide kinase-like protein, retinitis pigmentosa 26 (autosomal recessive), RP26

Gene Symbol

CERKL

Additional Ceramide Kinase Like Products

Product Documents for Ceramide Kinase Like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ceramide Kinase Like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ceramide Kinase Like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ceramide Kinase Like Antibody - BSA Free and earn rewards!

Have you used Ceramide Kinase Like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies