Recombinant Human CHMP1B His Protein

Novus Biologicals | Catalog # NBP1-98957

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

His

Applications

SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-199 of Human CHMP1B

Source: E.coli

Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Purity

>85%, by SDS-PAGE

Predicted Molecular Mass

24.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CHMP1B His Protein

SDS-PAGE: Recombinant Human CHMP1B His Protein [NBP1-98957]

SDS-PAGE: Recombinant Human CHMP1B His Protein [NBP1-98957]

SDS-Page: Recombinant Human CHMP1B His Protein [NBP1-98957] - 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Formulation, Preparation, and Storage

NBP1-98957
Formulation 20 mM Tris-HCl buffer (pH8.0), 20% glycerol, 0.1 M NaCl, 1 mM DTT
Preservative No Preservative
Concentration 0.25 mg/ml
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP1B

Alternate Names

C10orf2, c18orf2, charged multivesicular body protein 1b, CHMP1.5, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B

Gene Symbol

CHMP1B

Additional CHMP1B Products

Product Documents for Recombinant Human CHMP1B His Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human CHMP1B His Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human CHMP1B His Protein

There are currently no reviews for this product. Be the first to review Recombinant Human CHMP1B His Protein and earn rewards!

Have you used Recombinant Human CHMP1B His Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...