Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03043

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Cholecystokinin-B R/CCKBR Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 240-335 of human Cholecystokinin-B R/CCKBR (NP_795344.1). LISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRML

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

Western Blot: Cholecystokinin-B R/CCKBR AntibodyAzide and BSA Free [NBP3-03043]

Western Blot: Cholecystokinin-B R/CCKBR AntibodyAzide and BSA Free [NBP3-03043]

Western Blot: Cholecystokinin-B R/CCKBR Antibody [NBP3-03043] - Analysis of extracts of human stomach cancer tissue, using Cholecystokinin-B R/CCKBR antibody. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cholecystokinin-B R/CCKBR

CCKBR is a receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Long Name

Cholecystokinin B Receptor

Alternate Names

CCK-B, CCK2R, CCKBR, Cholecystokinin-BR, CholecystokininBR, GASR, Gastrin Receptor

Gene Symbol

CCKBR

Additional Cholecystokinin-B R/CCKBR Products

Product Documents for Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free and earn rewards!

Have you used Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies