CKII alpha prime polypeptide Antibody (3W5P4)

Name: CKII alpha prime polypeptide Antibody (3W5P4)
Brand: Novus Biologicals
SKU: NBP3-16076
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16076

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3W5P4 expressed in HEK293

View all CKII alpha prime polypeptide Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1). LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CKII alpha prime polypeptide Antibody (3W5P4)

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076] -

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076] - Western blot analysis of various lysates, using CKII alpha prime polypeptide Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for CKII alpha prime polypeptide Antibody (3W5P4)

Application

Recommended Usage

Immunoprecipitation

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CKII alpha prime polypeptide

CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.

Long Name

Casein kinase II subunit alpha'

Alternate Names

CK II alpha', CK2A2, CSNK2A2

Gene Symbol

CSNK2A2

Additional CKII alpha prime polypeptide Products

Product Documents for CKII alpha prime polypeptide Antibody (3W5P4)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CKII alpha prime polypeptide Antibody (3W5P4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKII alpha prime polypeptide Antibody (3W5P4)

There are currently no reviews for this product. Be the first to review CKII alpha prime polypeptide Antibody (3W5P4) and earn rewards!

Have you used CKII alpha prime polypeptide Antibody (3W5P4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image