CKII alpha prime polypeptide Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56690

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CKII alpha prime polypeptide Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha'.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CKII alpha prime polypeptide Antibody - BSA Free

Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56690]

Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56690]

Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56690] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for CKII alpha prime polypeptide Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CKII alpha prime polypeptide

CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Long Name

Casein kinase II subunit alpha'

Alternate Names

CK II alpha', CK2A2, CSNK2A2

Gene Symbol

CSNK2A2

UniProt

P19784 (Human)

Additional CKII alpha prime polypeptide Products

Product Documents for CKII alpha prime polypeptide Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CKII alpha prime polypeptide Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CKII alpha prime polypeptide Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CKII alpha prime polypeptide Antibody - BSA Free and earn rewards!

Have you used CKII alpha prime polypeptide Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies