Claudin-18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59250

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Claudin-18 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Claudin-18 Antibody - BSA Free

Western Blot: Claudin-18 Antibody [NBP1-59250]

Western Blot: Claudin-18 Antibody [NBP1-59250]

Western Blot: Claudin 18 Antibody [NBP1-59250] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Applications for Claudin-18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-18

CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884

Alternate Names

Claudin18, CLDN18, SFTA5, SFTPJ

Gene Symbol

CLDN18

UniProt

P56856 (Human)

Additional Claudin-18 Products

Product Documents for Claudin-18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Claudin-18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Claudin-18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Claudin-18 Antibody - BSA Free and earn rewards!

Have you used Claudin-18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies