Claudin-19 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP3-24745PEP
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: GDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP3-24745PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Claudin-19
Alternate Names
Gene Symbol
Additional Claudin-19 Products
Product Documents for Claudin-19 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Claudin-19 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Claudin-19 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review Claudin-19 Recombinant Protein Antigen and earn rewards!
Have you used Claudin-19 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review