CMTM6 Antibody (7N3H5)

Name: CMTM6 Antibody (7N3H5)
Brand: Novus Biologicals
SKU: NBP3-33341
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33341

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 7N3H5

View all CMTM6 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).

Sequence:
LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CMTM6 Antibody (7N3H5)

Western Blot: CMTM6 Antibody (7N3H5) [NBP3-33341] -

Western Blot: CMTM6 Antibody (7N3H5) [NBP3-33341] - Western blot analysis of various lysates, using CMTM6 Rabbit mAb at1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: CMTM6 Antibody (7N3H5) [NBP3-33341] -

Immunocytochemistry/ Immunofluorescence: CMTM6 Antibody (7N3H5) [NBP3-33341] - Immunofluorescence analysis of RAW264.7 cells using CMTM6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CMTM6 Antibody (7N3H5)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CMTM6

The CMTM6 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is

Long Name

CKLF Like MARVEL Transmembrane Domain Containing 6

Alternate Names

CKLFSF6, CMTM-6, FLJ20396, PRO2219

Gene Symbol

CMTM6

Additional CMTM6 Products

Product Documents for CMTM6 Antibody (7N3H5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CMTM6 Antibody (7N3H5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cell Cycle

Customer Reviews for CMTM6 Antibody (7N3H5)

There are currently no reviews for this product. Be the first to review CMTM6 Antibody (7N3H5) and earn rewards!

Have you used CMTM6 Antibody (7N3H5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image