Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-55950PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Coagulation Factor III/Tissue Factor.

Source: E. coli

Amino Acid Sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55950.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-55950PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Coagulation Factor III/Tissue Factor

Tissue Factor encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq]

Alternate Names

CD142, F3, Thromboplastin, Tissue Factor

Gene Symbol

F3

Additional Coagulation Factor III/Tissue Factor Products

Product Documents for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Coagulation Factor III/Tissue Factor Recombinant Protein Antigen and earn rewards!

Have you used Coagulation Factor III/Tissue Factor Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Coagulation Factor III/Tissue Factor Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Have you tested any of your anti-tissue factor antibodies against pig? I need one for western blot.

    A:

    Unfortunately, none of our Tissue Factor antibodies have yet been tested with pig samples, so we cannot guarantee that any of them will work in pig. Here is a link to Tissue Factor antibodies that have been validated for use in Western blot. If you are interested in testing any of these antibodies against pig samples, you could become eligible for our Innovator's Reward program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...

Associated Pathways

Blood Coagulation Signaling Pathways
Blood Coagulation Signaling Pathway Thumbnail