Coagulation Factor VII Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68896

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Coagulation Factor VII Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to F7 (coagulation factor VII (serum prothrombin conversion accelerator)) The peptide sequence was selected form the middle region of F7. Peptide sequence RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Coagulation Factor VII Antibody - BSA Free

Western Blot: Coagulation Factor VII Antibody [NBP1-68896]

Western Blot: Coagulation Factor VII Antibody [NBP1-68896]

Western Blot: Factor VII Antibody [NBP1-68896] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for Coagulation Factor VII Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Coagulation Factor VII

This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Alternative splicing of this gene results in 2 transcripts. Defects in this gene can cause coagulopathy.

Long Name

Coagulation Factor VII (Serum Prothrombin Conversion Accelerator)

Alternate Names

F7

Gene Symbol

F7

OMIM

NP_000122 (Human)

UniProt

P08709 (Human)

Additional Coagulation Factor VII Products

Product Documents for Coagulation Factor VII Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Coagulation Factor VII Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Coagulation Factor VII Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Coagulation Factor VII Antibody - BSA Free and earn rewards!

Have you used Coagulation Factor VII Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail