Coagulation Factor XI Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58427

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Coagulation Factor XI Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Coagulation Factor XI Antibody [NBP2-58427]

Immunocytochemistry/ Immunofluorescence: Coagulation Factor XI Antibody [NBP2-58427]

Immunocytochemistry/Immunofluorescence: Coagulation Factor XI Antibody [NBP2-58427] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.

Applications for Coagulation Factor XI Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Coagulation Factor XI

Factor XI encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq]

Alternate Names

coagulation factor XI, EC 3.4.21, EC 3.4.21.27, FXIPlasma thromboplastin antecedent, MGC141891, PTA

Gene Symbol

F11

Additional Coagulation Factor XI Products

Product Documents for Coagulation Factor XI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Coagulation Factor XI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Coagulation Factor XI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Coagulation Factor XI Antibody - BSA Free and earn rewards!

Have you used Coagulation Factor XI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Blood Coagulation Signaling Pathways Blood Coagulation Signaling Pathway Thumbnail