COLEC10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10703

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CL-L1/COLEC10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COLEC10 (NP_006429). Peptide sequence IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for COLEC10 Antibody - BSA Free

Western Blot: COLEC10 Antibody [NBP3-10703]

Western Blot: COLEC10 Antibody [NBP3-10703]

Western Blot: COLEC10 Antibody [NBP3-10703] - Western blot analysis of COLEC10 in U937 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for COLEC10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CL-L1/COLEC10

COLEC10 encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. The other members of this family are secreted proteins and bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. This gene product is a cytosolic protein, a characteristic that suggests that it may have different biological functions than other C-lectins. [provided by RefSeq]

Long Name

Collectin Liver 1

Alternate Names

CL-34, COLEC10, Collectin-10, Collectin-34

Gene Symbol

COLEC10

Additional CL-L1/COLEC10 Products

Product Documents for COLEC10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for COLEC10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

C-type Lectin Family

Customer Reviews for COLEC10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review COLEC10 Antibody - BSA Free and earn rewards!

Have you used COLEC10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies